NSJ Bioreagents

MBD1 Antibody

Product Code:
 
NSJ-RQ5826
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
 
After reconstitution, the MBD1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
1 / 3
Flow cytometry testing of human A549 cells with MBD1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MBD1 antibody.
2 / 3
Flow cytometry testing of human U-2 OS cells with MBD1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MBD1 antibody.
3 / 3
Western blot testing of human 1) Jurkat, 2) HeLa, 3) HEK293, 4) HepG2, 5) U-2 OS, 6) rat thymus, 7) mouse thymus and 8) mouse SP2/0 lysate with MBD1 antibody. Predicted molecular weight ~67 kDa.

Flow cytometry testing of human A549 cells with MBD1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MBD1 antibody.
Flow cytometry testing of human U-2 OS cells with MBD1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MBD1 antibody.
Western blot testing of human 1) Jurkat, 2) HeLa, 3) HEK293, 4) HepG2, 5) U-2 OS, 6) rat thymus, 7) mouse thymus and 8) mouse SP2/0 lysate with MBD1 antibody. Predicted molecular weight ~67 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ5826-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the MBD1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
MBD1 (Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al.(1999) mapped the MBD1 gene to chromosome 18q21, 2.1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al.(2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain(TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al.(2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DLTLFDFKQGILCYPAPKAHPVAVASKKRK from the human protein were used as the immunogen for the MBD1 antibody.
Limitation:
This MBD1 antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9UIS9