NSJ Bioreagents

RAB11A Antibody (Antigen affinity purified)

Product Code:
 
NSJ-RQ6583
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
4H9
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the RAB11A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 8
IHC staining of FFPE human gastric carcinoma tissue with RAB11A antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 8
IHC staining of FFPE human spleen tissue with RAB11A antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE human placental tissue with RAB11A antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 8
Immunofluorescent staining of FFPE human T-47D cells with RAB11A antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
5 / 8
Western blot testing of 1) human HeLa, 2) human placenta, 3) human COLO-320, 4) human MDA-MB-453, 5) rat testis, 6) rat brain, 7) mouse testis and 8) mouse brain tissue lysate with RAB11A antibody. Predicted molecular weight: ~25 kDa.
6 / 8
Flow cytometry testing of human U937 cells with RAB11A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB11A antibody.
7 / 8
Flow cytometry testing of mouse ANA-1 cells with RAB11A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB11A antibody.
8 / 8
Flow cytometry testing of rat RH35 cells with RAB11A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB11A antibody.

IHC staining of FFPE human gastric carcinoma tissue with RAB11A antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human spleen tissue with RAB11A antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with RAB11A antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human T-47D cells with RAB11A antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HeLa, 2) human placenta, 3) human COLO-320, 4) human MDA-MB-453, 5) rat testis, 6) rat brain, 7) mouse testis and 8) mouse brain tissue lysate with RAB11A antibody. Predicted molecular weight: ~25 kDa.
Flow cytometry testing of human U937 cells with RAB11A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB11A antibody.
Flow cytometry testing of mouse ANA-1 cells with RAB11A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB11A antibody.
Flow cytometry testing of rat RH35 cells with RAB11A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAB11A antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6583-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the RAB11A antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Ras-related protein Rab-11A is a protein that in humans is encoded by the RAB11A gene. The protein encoded by this gene belongs to the small GTPase superfamily, Rab family which plays essential roles in vesicle and granule targeting. It is mapped to 15q22.31. RAB11A is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Additionally, RAB11A can control intracellular trafficking of the innate immune receptor TLR4, and thereby also receptor signaling. It has been shown to interact with RAB11FIP2, RAB11FIP4, and RAB11FIP1 and so on.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
C-terminal region amino acids EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ from the human protein were used as the immunogen for the RAB11A antibody.
Limitation:
This RAB11A antibody is available for research use only.
Localization:
Cytoplasmic, cell membrane
Purity:
Antigen affinity purified
Uniprot #:
P62491

Documents