NSJ Bioreagents

Cyclin T1 Antibody / CCNT1 (Antigen affinity purified)

Product Code:
 
NSJ-RQ6588
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Mouse
Antibody Isotype:
 
Mouse IgG2b
Antibody Clonality:
 
Monoclonal
Antibody Clone:
 
3B7
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Monkey
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
 
After reconstitution, the CCNT1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
1 / 2
Flow cytometry testing of human U-2 OS cells with CCNT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCNT1 antibody.~
2 / 2
Western blot testing of 1) human Jurkat, 2) human HeLa, 3) human SW620 a

Flow cytometry testing of human U-2 OS cells with CCNT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCNT1 antibody.~
Western blot testing of 1) human Jurkat, 2) human HeLa, 3) human SW620 a

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-RQ6588-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details:
Western blot: 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CCNT1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELQKRQLENM from the human protein were used as the immunogen for the CCNT1 antibody.
Limitation:
This CCNT1 antibody is available for research use only.
Purity:
Antigen affinity purified
Uniprot #:
O60563

Documents