NSJ Bioreagents

Annexin IV Antibody

Product Code:
 
NSJ-R32677
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the Annexin IV antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 8
IHC staining of FFPE human placental tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 8
IHC staining of FFPE human breast cancer tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE human colonic adenoma tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 8
IHC staining of FFPE human liver cancer tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 8
IHC staining of FFPE mouse liver tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 8
IHC staining of FFPE rat liver tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 8
Western blot testing of human 1) HepG2, 2) A549, 3) ThP-1, 4) HACAT, 5) rat stomach, 6) rat lung, 7) mouse stomach and 8) mouse lung tissue lysate with Annexin IV antibody. Predicted molecular weight ~36 kDa.
8 / 8
Flow cytometry testing of human HEL cells with Annexin IV antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Annexin IV antibody.
❮❯

IHC staining of FFPE human placental tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colonic adenoma tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse liver tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat liver tissue with Annexin IV antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HepG2, 2) A549, 3) ThP-1, 4) HACAT, 5) rat stomach, 6) rat lung, 7) mouse stomach and 8) mouse lung tissue lysate with Annexin IV antibody. Predicted molecular weight ~36 kDa.
Flow cytometry testing of human HEL cells with Annexin IV antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Annexin IV antibody.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32677-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Annexin IV antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 119-152 (EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL) from the human protein were used as the immunogen for the Annexin IV antibody.
Limitation:
This Annexin IV antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P09525