NSJ Bioreagents

CD47 Antibody / IAP / Integrin Associated Protein

Product Code:
 
NSJ-R32830
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
 
Human
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the CD47 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of human 1) MCF7, 2) SK-OV-3 and 3) PANC-1 cell lysate with CD47 antibody at 0.5ug/ml. Predicted molecular weight: 35~60 kDa depending on glycosylation level.
❮❯

Western blot testing of human 1) MCF7, 2) SK-OV-3 and 3) PANC-1 cell lysate with CD47 antibody at 0.5ug/ml. Predicted molecular weight: 35~60 kDa depending on glycosylation level.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32830-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the CD47 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
CD47, also known as IAP or MER6, is a transmembrane protein that in humans is encoded by the CD47 gene. CD47 gene belongs to the immunoglobulin superfamily. This gene is mapped to 3q13.12. CD47 gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT were used as the immunogen for the CD47 antibody.
Limitation:
This CD47 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
Q08722