NSJ Bioreagents

ICA1 Antibody

Product Code:
 
NSJ-R32190
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the ICA1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) human SH-SY5Y, 2) human RT4, 3) human MCF7, 4) human K562, 5) rat pancreas, 6) rat brain, 7) mouse pancreas and 8) mouse brain tissue lysate with ICA1 antibody. Predicted molecular weight ~55 kDa but can also be observed at 64-69 kDa.

Western blot testing of 1) human SH-SY5Y, 2) human RT4, 3) human MCF7, 4) human K562, 5) rat pancreas, 6) rat brain, 7) mouse pancreas and 8) mouse brain tissue lysate with ICA1 antibody. Predicted molecular weight ~55 kDa but can also be observed at 64-69 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32190-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the ICA1 antibody should be determined by the researcher.
Description:
Islet cell autoantigen 1 is a protein that in humans is encoded by the ICA1 gene. It is mapped to 7p22. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. What?s more, this protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Several transcript variants encoding two different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK of human ICA1 were used as the immunogen for the ICA1 antibody.
Limitation:
This ICA1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q05084