NSJ Bioreagents

Monoamine Oxidase A Antibody / MAOA

Product Code:
 
NSJ-R32008
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the MAOA antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 7
Immunofluorescent staining of FFPE human U-2 OS cells with MAOA antibody (green) at 5ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 7
IHC testing of FFPE human intestinal cancer with MAOA antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 7
IHC testing of FFPE mouse heart with MAOA antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 7
IHC testing of FFPE rat heart with MAOA antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 7
Flow cytometry testing of human U-87 MG cells with MAOA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MAOA antibody.
6 / 7
Flow cytometry testing of human U-2 OS cells with MAOA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MAOA antibody.
7 / 7
Western blot testing of 1) rat kidney, 2) mouse kidney, 3) human COLO320, 4) human HepG2 and 5) mouse HEPA lysate with MAOA antibody. Expected/observed molecular weight ~60 kDa.

Immunofluorescent staining of FFPE human U-2 OS cells with MAOA antibody (green) at 5ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human intestinal cancer with MAOA antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse heart with MAOA antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat heart with MAOA antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human U-87 MG cells with MAOA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MAOA antibody.
Flow cytometry testing of human U-2 OS cells with MAOA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MAOA antibody.
Western blot testing of 1) rat kidney, 2) mouse kidney, 3) human COLO320, 4) human HepG2 and 5) mouse HEPA lysate with MAOA antibody. Expected/observed molecular weight ~60 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32008-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence (FFPE): 5-7ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the MAOA antibody should be determined by the researcher.
Description:
Monoamine oxidase A is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER of human MAOA were used as the immunogen for the MAOA antibody.
Limitation:
This MAOA antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P21397