NSJ Bioreagents

Phospholamban Antibody / PLN

Product Code:
 
NSJ-R32038
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the PLN antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
IHC staining of FFPE mouse heart tissue with PLN antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 3
IHC staining of FFPE rat heart tissue with PLN antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 3
Western blot testing of 1) mouse heart, 2) rat heart, 3) human COLO320 and 4) human K562 lysate with PLN antibody. Predicted molecular weight: 6/18/24/36 kDa (monomer/oligomers).

IHC staining of FFPE mouse heart tissue with PLN antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat heart tissue with PLN antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) mouse heart, 2) rat heart, 3) human COLO320 and 4) human K562 lysate with PLN antibody. Predicted molecular weight: 6/18/24/36 kDa (monomer/oligomers).

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32038-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml
Application Note:
Optimal dilution of the PLN antibody should be determined by the researcher.
Description:
Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells. It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, with markedly lower expression observed in smooth muscles, while the right atrium also expressed low levels of phospholamban. The structure of the human phospholamban gene closely resembles that reported for chicken, rabbit, rat, and mouse. Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF of human PLN were used as the immunogen for the PLN antibody.
Limitation:
This PLN antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P26678