Calcitonin Antibody / CALCA / CGRP
| Code | Size | Price |
|---|
| NSJ-RQ4462-100ug | 100ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Mouse
- Rat
Application: Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
After reconstitution, the Calcitonin antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Calcitonin antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP were used as the immunogen for the Calcitonin antibody.
Limitation:
This Calcitonin antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Mouse, Rat
Uniprot #:
P70160