Thrombospondin 2 Antibody / THBS2

NSJ Bioreagents
Product Code: NSJ-RQ4469
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4469-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the THBS2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of 1) rat brain and 2) mouse brain lysate with THBS2 antibody at 0.5ug/ml. Expected molecular weight: 130-170 kDa depending on glycosylation level.

Western blot testing of 1) rat brain and 2) mouse brain lysate with THBS2 antibody at 0.5ug/ml. Expected molecular weight: 130-170 kDa depending on glycosylation level.

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the THBS2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Thrombospondin-2 (THBS2) is a protein that in humans is encoded by the THBS2 gene. The protein encoded by this gene belongs to the thrombospondin family. The THBS2 is mapped to 6q27 and it is located on chromosome 17. The gene was transcribed in fibroblasts, smooth muscle cells, and an osteosarcoma cell line. It functions as a protein inhibitor of tumor growth and angiogenesis and modulates the cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DHVKDTSFDLFSISNINRKTIGAKQFRGPD were used as the immunogen for the THBS2 antibody.
Limitation:
This THBS2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Mouse, Rat
Uniprot #:
P35442