HSP70 Antibody / HSPA1A / HSPA1B

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4486
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4486-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 3H5
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the HSP70 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of human 1) HeLa, 2) COLO-320, 3) SW620, 4) A431, 5) A549, 6) HepG2 and 7) PANC-1 lysate with HSP70 antibody at 0.5ug/ml. Expected molecular weight ~70 kDa.
2 / 4
Flow cytometry testing of human U-2 OS cells with HSP70 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HSP70 antibody.
3 / 4
IHC testing of FFPE human lung cancer with HSP70 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 4
Immunofluorescent staining of FFPE human MCF7 cells with HSP70 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
❮❯

Western blot testing of human 1) HeLa, 2) COLO-320, 3) SW620, 4) A431, 5) A549, 6) HepG2 and 7) PANC-1 lysate with HSP70 antibody at 0.5ug/ml. Expected molecular weight ~70 kDa.
Flow cytometry testing of human U-2 OS cells with HSP70 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HSP70 antibody.
IHC testing of FFPE human lung cancer with HSP70 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Immunofluorescent staining of FFPE human MCF7 cells with HSP70 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow Cytometry: 1-3ug/10^6 cells,Immunofluorescence: 2-4ug/ml
Application Note:
Optimal dilution of the HSP70 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
HSPA1 (Heat Shock 70kDa Protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR were used as the immunogen for the HSP70 antibody. This sequence is common to HSPA1A and HSPA1B.
Limitation:
This HSP70 antibody is available for research use only.
Localization:
Cytoplasm
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
P0DMV8