RBBP4 Antibody / RbAp48 / NURF55

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4496
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4496-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 9F3
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the RbAp48 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) A549, 2) Jurkat, 3) HeLa and 4) PANC-1 lysate with RbAp48 antibody at 0.5ug/ml. Expected molecular weight: 48~55 kDa.
2 / 3
IHC testing of FFPE human intestinal cancer with RbAp48 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 3
IHC testing of FFPE human placenta with RbAp48 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
❮❯

Western blot testing of human 1) A549, 2) Jurkat, 3) HeLa and 4) PANC-1 lysate with RbAp48 antibody at 0.5ug/ml. Expected molecular weight: 48~55 kDa.
IHC testing of FFPE human intestinal cancer with RbAp48 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human placenta with RbAp48 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the RbAp48 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS were used as the immunogen for the RbAp48 antibody.
Limitation:
This RbAp48 antibody is available for research use only.
Localization:
Nucleus
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
Q09028