AMPK beta 2 Antibody / PRKAB2

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4500
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4500-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 6G1
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the PRKAB2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Flow cytometry testing of human PC-3 cells with PRKAB2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PRKAB2 antibody.
2 / 2
Western blot testing of human 1) HeLa, 2) placenta, 3) 293T, 4) A549, 5) A375, 6) A431, 7) U-2 OS and 8) K562 lysate with PRKAB2 antibody at 0.5ug/ml. Predicted molecular weight ~30 kDa.
❮❯

Flow cytometry testing of human PC-3 cells with PRKAB2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= PRKAB2 antibody.
Western blot testing of human 1) HeLa, 2) placenta, 3) 293T, 4) A549, 5) A375, 6) A431, 7) U-2 OS and 8) K562 lysate with PRKAB2 antibody at 0.5ug/ml. Predicted molecular weight ~30 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow Cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the PRKAB2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE were used as the immunogen for the PRKAB2 antibody.
Limitation:
This PRKAB2 antibody is available for research use only.
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
O43741