SMN1/2 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4524
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4524-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 2B10
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunocytochemistry (ICC)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the SMN1/2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
IHC testing of FFPE human breast cancer with SMN1/2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
2 / 4
IHC testing of FFPE human breast cancer with SMN1/2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 4
ICC testing of FFPE human A431 cells with SMN1/2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 4
Western blot testing of human 1) HeLa, 2) placenta, 3) SW620, 4) PANC-1, 5) HepG2, 6) A549, 7) rat RH35 and 8) mouse HEPA1-6 lysate with SMN1/2 antibody at 0.5ug/ml. Expected molecular weight: 32-38 kDa.
❮❯

IHC testing of FFPE human breast cancer with SMN1/2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human breast cancer with SMN1/2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
ICC testing of FFPE human A431 cells with SMN1/2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of human 1) HeLa, 2) placenta, 3) SW620, 4) PANC-1, 5) HepG2, 6) A549, 7) rat RH35 and 8) mouse HEPA1-6 lysate with SMN1/2 antibody at 0.5ug/ml. Expected molecular weight: 32-38 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunocytochemistry: 0.5-1ug/ml
Application Note:
Optimal dilution of the SMN1/2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Multiple transcript variants encoding distinct isoforms have been described.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RRGTGQSDDSDIWDDTALIKAYDKAVASFKH were used as the immunogen for the SMN1/2 antibody.
Limitation:
This SMN1/2 antibody is available for research use only.
Localization:
Nucleus
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
Q16637