P Glycoprotein Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4527
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4527-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the P Glycoprotein antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Immunofluorescent staining of FFPE human U-2 OS cells with P Glycoprotein antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Flow cytometry testing of human U-2 OS cells with P Glycoprotein antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P Glycoprotein antibody.
3 / 3
Western blot testing of human 1) THP-1 and 2) A375 cell lysate with P Glycoprotein antibody at 0.5ug/ml. Expected molecular weight: 141-180 kDa depending on glycosylation level.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with P Glycoprotein antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U-2 OS cells with P Glycoprotein antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= P Glycoprotein antibody.
Western blot testing of human 1) THP-1 and 2) A375 cell lysate with P Glycoprotein antibody at 0.5ug/ml. Expected molecular weight: 141-180 kDa depending on glycosylation level.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the P Glycoprotein antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY were used as the immunogen for the P Glycoprotein antibody.
Limitation:
This P Glycoprotein antibody is available for research use only.
Localization:
Cell membrane
Purity:
Protein A affinity
Species Reactivity :
Human
Uniprot #:
P08183