DOG-1 Antibody / TMEM16A / ANO1

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4536
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4536-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the TMEM16A antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) HeLa, 2) HepG2, 3) A549, 4) PANC-1, 5) SK-OV-3, 6) SGC-7901 and 7) COLO-320 lysate with TMEM16A antibody at 0.5ug/ml. Expected molecular weight 114~130 kDa depending on glycosylation level.
2 / 3
IHC staining of FFPE human esophagus squama cancer with TMEM16A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 3
Flow cytometry testing of human A431 cells with TMEM16A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TMEM16A antibody.
❮❯

Western blot testing of human 1) HeLa, 2) HepG2, 3) A549, 4) PANC-1, 5) SK-OV-3, 6) SGC-7901 and 7) COLO-320 lysate with TMEM16A antibody at 0.5ug/ml. Expected molecular weight 114~130 kDa depending on glycosylation level.
IHC staining of FFPE human esophagus squama cancer with TMEM16A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Flow cytometry testing of human A431 cells with TMEM16A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TMEM16A antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the TMEM16A antibody should be determined by the researcher.
Description:
Anoctamin-1 (ANO1), also known as oral cancer overexpressed 2 (ORAOV2) or tumor-amplified and overexpressed sequence 2 (TMEM16A), is a protein that in humans is encoded by the ANO1 gene. This gene belongs to a family of membrane proteins containing 8 transmembrane segments, and it is mapped to 11q13.3. TMEM16A is a candidate calcium-activated chloride channel that mediates receptor-activated chloride currents in diverse physiologic processes, and it is thought to be responsible for a voltage-sensitive calcium-activated chloride current. Its overexpression was reported in esophageal squamous cell carcinoma and breast cancer progression Crofelemer, an antidiarrhoeal, inhibits this channel. TMEM16A has eight transmembrane domains, its pore is large and non-selective, allowing other negatively charged species to permeate.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDE were used as the immunogen for the TMEM16A antibody.
Limitation:
This TMEM16A antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
Q5XXA6