Doppel Antibody / PRND

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4601
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4601-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Doppel antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of 1) human SHG-44, 2) rat testis, 3) rat kidney, 4) mouse testis, 5) mouse kidney and 6) mouse brain lysate with Doppel antibody at 0.5ug/ml. Predicted molecular weight ~20 kDa.
2 / 3
IHC staining of FFPE human testis with Doppel antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 3
IHC staining of FFPE mouse testis with Doppel antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
❮❯

Western blot testing of 1) human SHG-44, 2) rat testis, 3) rat kidney, 4) mouse testis, 5) mouse kidney and 6) mouse brain lysate with Doppel antibody at 0.5ug/ml. Predicted molecular weight ~20 kDa.
IHC staining of FFPE human testis with Doppel antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse testis with Doppel antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Doppel antibody should be determined by the researcher.
Description:
Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH were used as the immunogen for the Doppel antibody.
Localization:
Cytoplasm, plasma membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9UKY0