RAD51 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4603
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4603-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the RAD51 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 8
IHC staining of FFPE human testis with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
2 / 8
IHC staining of FFPE human placenta with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 8
IHC staining of FFPE mouse brain with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 8
Western blot testing of human 1) HeLa, 2) A431, 3) 293T, 4) K562, 5) Jurkat, 6) A549 and 7) Caco-2 lysate with RAD51 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
5 / 8
Western blot testing of 1) rat testis, 2) mouse testis and 3) mouse thymus lysate with RAD51 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
6 / 8
IHC staining of FFPE rat brain with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
7 / 8
Immunofluorescent staining of FFPE human U-2 OS cells with RAD51 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
8 / 8
Flow cytometry testing of human SiHa cells with RAD51 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAD51 antibody.
❮❯

IHC staining of FFPE human testis with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human placenta with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse brain with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of human 1) HeLa, 2) A431, 3) 293T, 4) K562, 5) Jurkat, 6) A549 and 7) Caco-2 lysate with RAD51 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
Western blot testing of 1) rat testis, 2) mouse testis and 3) mouse thymus lysate with RAD51 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
IHC staining of FFPE rat brain with RAD51 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Immunofluorescent staining of FFPE human U-2 OS cells with RAD51 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human SiHa cells with RAD51 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RAD51 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the RAD51 antibody should be determined by the researcher.
Description:
DNA repair protein RAD51 homolog 1, also known as RAD51A, is a human gene. The Rad51 gene, HsRAD51, is a homolog of RecA of Escherichia coli and functions in recombination and DNA repair. BRCA1 and BRCA2 proteins form a complex with Rad51, and these genes are thought to participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51 is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK were used as the immunogen for the RAD51 antibody.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q06609