RXFP2 Antibody / Relaxin Receptor 2

NSJ Bioreagents
Product Code: NSJ-RQ4608
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4608-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the RXFP2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of human SHG-44 cell lysate with RXFP2 antibody at 0.5ug/ml. Predicted molecualr weight ~86 kDa.
2 / 2
Flow cytometry testing of human U251 cells with RXFP2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RXFP2 antibody.

Western blot testing of human SHG-44 cell lysate with RXFP2 antibody at 0.5ug/ml. Predicted molecualr weight ~86 kDa.
Flow cytometry testing of human U251 cells with RXFP2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RXFP2 antibody.

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the RXFP2 antibody should be determined by the researcher.
Description:
Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ were used as the immunogen for the RXFP2 antibody.
Limitation:
This RXFP2 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
Q8WXD0