TANK Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4612
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4612-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the TANK antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 7
Western blot testing of human 1) HeLa, 2) placenta, 3) A549, 4) MDA-MB-453, 5) SW620, 6) 22RV1 and 7) SW579 with TANK antibody at 0.5ug/ml. Expected molecular weight ~48 kDa.
2 / 7
Western blot testing of 1) rat brain, 2) rat lung, 3) rat spleen, 4) rat kidney, 5) mouse brain, 6) mouse lung, 7) mouse spleen and 8) mouse kidney with TANK antibody at 0.5ug/ml. Expected molecular weight ~48 kDa.
3 / 7
IHC staining of FFPE human cholangiocarcinoma with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 7
IHC staining of FFPE human rectal cancer with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
5 / 7
IHC staining of FFPE human placenta with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
6 / 7
IHC staining of FFPE rat small intestine with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
7 / 7
IHC staining of FFPE rat spleen with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
❮❯

Western blot testing of human 1) HeLa, 2) placenta, 3) A549, 4) MDA-MB-453, 5) SW620, 6) 22RV1 and 7) SW579 with TANK antibody at 0.5ug/ml. Expected molecular weight ~48 kDa.
Western blot testing of 1) rat brain, 2) rat lung, 3) rat spleen, 4) rat kidney, 5) mouse brain, 6) mouse lung, 7) mouse spleen and 8) mouse kidney with TANK antibody at 0.5ug/ml. Expected molecular weight ~48 kDa.
IHC staining of FFPE human cholangiocarcinoma with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human rectal cancer with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human placenta with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat small intestine with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat spleen with TANK antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the TANK antibody should be determined by the researcher.
Description:
TRAF family member-associated NF-kappa-B activator is a protein that in humans is encoded by the TANK gene. It is mapped to 2q24.2. The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK were used as the immunogen for the TANK antibody.
Limitation:
This TANK antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q92844