NONO Antibody / p54nrb

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4624
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4624-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 11E2-
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunocytochemistry (ICC)
  • Western Blot (WB)
Storage:
After reconstitution, the NONO antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) HeLa, 2) placenta, 3) MCF7, 4) A549, 5) SW620, 6) PANC-1, 7) U-2 OS and 8) K562 lysate with NONO antibody at 0.5ug/ml. Predicted molecular weight ~54 kDa.
2 / 3
ICC staining of FFPE human A431 cells with NONO antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 3
Flow cytometry testing of human U-2 OS cells with NONO antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NONO antibody.
❮❯

Western blot testing of human 1) HeLa, 2) placenta, 3) MCF7, 4) A549, 5) SW620, 6) PANC-1, 7) U-2 OS and 8) K562 lysate with NONO antibody at 0.5ug/ml. Predicted molecular weight ~54 kDa.
ICC staining of FFPE human A431 cells with NONO antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human U-2 OS cells with NONO antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NONO antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunocytochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the NONO antibody should be determined by the researcher.
Description:
Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ were used as the immunogen for the NONO antibody.
Limitation:
This NONO antibody is available for research use only.
Localization:
Nuclear
Purity:
Protein G affinity
Species Reactivity :
Human
Uniprot #:
Q15233