PKC gamma Antibody / PRKCG

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4657
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4657-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the PKC gamma antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 8
Immunofluorescent staining of FFPE rat cerebellum tissue with PKC gamma antibody (red), GFAP antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
2 / 8
Immunofluorescent staining of FFPE rat cerebellum tissue with PKC gamma antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
3 / 8
Immunofluorescent staining of FFPE human SH-SY5Y cells with PKC gamma antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
4 / 8
IHC staining of FFPE human glioma with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
5 / 8
IHC staining of FFPE mouse brain with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
6 / 8
IHC staining of FFPE mouse cerebellum with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
7 / 8
IHC staining of FFPE rat brain with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
8 / 8
Western blot testing of 1) human U-87 MG, 2) rat brain, 3) mouse brain, 4) rat kidney and 5) mouse kidney lysate with PKC gamma antibody at 0.5ug/ml. Predicted molecular weight ~78 kDa.
❮❯

Immunofluorescent staining of FFPE rat cerebellum tissue with PKC gamma antibody (red), GFAP antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE rat cerebellum tissue with PKC gamma antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE human SH-SY5Y cells with PKC gamma antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human glioma with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse brain with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse cerebellum with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat brain with PKC gamma antibody at 1ug/ml. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of 1) human U-87 MG, 2) rat brain, 3) mouse brain, 4) rat kidney and 5) mouse kidney lysate with PKC gamma antibody at 0.5ug/ml. Predicted molecular weight ~78 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence: 5ug/ml
Application Note:
Optimal dilution of the PKC gamma antibody should be determined by the researcher.
Description:
The gamma isotype of protein kinase C (PKC gamma) is a member of the classical PKC (cPKC) subfamily which is activated by Ca(2+) and diacylglycerol in the presence of phosphatidylserine. Physiologically, PKC gamma is activated by a mechanism coupled with receptor-mediated breakdown of inositol phospholipid as other cPKC isotypes such as PKC alpha and PKC beta. PKC gamma is expressed solely in the brain and spinal cord and its localization is restricted to neurons, while PKC alpha and PKC beta are expressed in many tissues in addition to the brain. Within the brain, PKC gamma is the most abundant in the cerebellum, hippocampus and cerebral cortex, where the existence of neuronal plasticity has been demonstrated. PKC gamma gene is mutated in spinocerebellar ataxia type 14 (SCA14). Verbeek et al. (2005) point out the specific alterations in mutant PKC gamma function that could lead to the selective neuronal degeneration of SCA14.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DRLVLASIDQADFQGFTYVNPDFVHPDARS were used as the immunogen for the PKC gamma antibody.
Limitation:
This PKC gamma antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P05129