PYY Antibody / Peptide YY

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4658
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4658-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Mouse
  • Rat
Application: Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
After reconstitution, the Peptide YY antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
IHC staining of FFPE mouse small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
2 / 4
IHC staining of FFPE mouse small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
3 / 4
IHC staining of FFPE rat small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
4 / 4
IHC staining of FFPE rat small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
❮❯

IHC staining of FFPE mouse small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat small intestine with PYY antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.

Documents

Further Information

Application Details :
Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the Peptide YY antibody should be determined by the researcher.
Description:
Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY were used as the immunogen for the Peptide YY antibody.
Limitation:
This PYY antibody is available for research use only.
Localization:
Secreted
Purity:
Antigen affinity purified
Species Reactivity :
Mouse, Rat
Uniprot #:
P10082