HAS1 Antibody / Hyaluronan synthase 1

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4648
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4648-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Antibody Clone: n/a
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
After reconstitution, the HAS1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 8
Western blot testing of 1) human SHG-44, 2) human ThP-1, 3) rat brain, 4) rat smooth muscle, 5) rat ovary, 6) mouse brain, 7) mouse smooth muscle, 8) mouse ovary, 9) mouse small intestine and 10) mouse Neuro-2a lysate with HAS1 antibody at 0.5ug/ml. Predicted molecular weight ~63 kDa.
2 / 8
IHC staining of FFPE human breast cancer with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE human breast cancer with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
4 / 8
IHC staining of FFPE human lung cancer with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
5 / 8
IHC staining of FFPE mouse spleen with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
6 / 8
IHC staining of FFPE rat small intestine with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
7 / 8
IF/ICC staining of FFPE human U-2 OS cells with HAS1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
8 / 8
Flow cytometry testing of human U-87 MG cells with HAS1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HAS1 antibody.
❮❯

Western blot testing of 1) human SHG-44, 2) human ThP-1, 3) rat brain, 4) rat smooth muscle, 5) rat ovary, 6) mouse brain, 7) mouse smooth muscle, 8) mouse ovary, 9) mouse small intestine and 10) mouse Neuro-2a lysate with HAS1 antibody at 0.5ug/ml. Predicted molecular weight ~63 kDa.
IHC staining of FFPE human breast cancer with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE mouse spleen with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE rat small intestine with HAS1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IF/ICC staining of FFPE human U-2 OS cells with HAS1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U-87 MG cells with HAS1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HAS1 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence/Immunocytochemistry: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the HAS1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA were used as the immunogen for the HAS1 antibody.
Limitation:
This HAS1 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q92839