SLC34A2 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4878
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4878-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Antibody Clone: n/a
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
After reconstitution, the SLC34A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 7
Immunofluorescent staining of FFPE human A431 cells with SLC34A2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 7
IHC staining of FFPE human lung cancer with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE human lung cancer with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE mouse lung with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
5 / 7
IHC staining of FFPE rat lung with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
6 / 7
Western blot testing of human 1) HEK293 and 2) K562 cell lysate with SLC34A2 antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa, but may be observed at up to ~130 kDa due to glycosylation.
7 / 7
Flow cytometry testing of human SiHa cells with SLC34A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SLC34A2 antibody.
❮❯

Immunofluorescent staining of FFPE human A431 cells with SLC34A2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human lung cancer with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE mouse lung with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE rat lung with SLC34A2 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
Western blot testing of human 1) HEK293 and 2) K562 cell lysate with SLC34A2 antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa, but may be observed at up to ~130 kDa due to glycosylation.
Flow cytometry testing of human SiHa cells with SLC34A2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SLC34A2 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the SLC34A2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Sodium-dependent phosphate transport protein 2B (NaPi2b) is a protein that in humans is encoded by the SLC34A2 gene. The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QNWTMKNVTYKENIAKCQHIFVNFHLPDLA from the human protein were used as the immunogen for the SLC34A2 antibody.
Limitation:
This SLC34A2 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O95436