CHM Antibody / Choroideremia protein

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4899
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4899-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Antibody Clone: n/a
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunocytochemistry (ICC)
  • Immunofluorescence (IF)
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
After reconstitution, the CHM antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 9
Western blot testing of human 1) HeLa, 2) U-87 MG, 3) A431, 4) K562, 5) A549, 6) Caco-2, 7) rat stomach and 8) mouse stomach lysate with CHM antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
2 / 9
IF/ICC staining of FFPE human A431 cells with CHM antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
3 / 9
Flow cytometry testing of human SiHa cells with CHM antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CHM antibody.
4 / 9
IHC staining of FFPE human thyroid cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
5 / 9
IHC staining of FFPE human intestinal cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
6 / 9
IHC staining of FFPE human lung cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
7 / 9
IHC staining of FFPE human placenta with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
8 / 9
IHC staining of FFPE mouse small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
9 / 9
IHC staining of FFPE rat small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
❮❯

Western blot testing of human 1) HeLa, 2) U-87 MG, 3) A431, 4) K562, 5) A549, 6) Caco-2, 7) rat stomach and 8) mouse stomach lysate with CHM antibody at 0.5ug/ml. Predicted molecular weight ~73 kDa.
IF/ICC staining of FFPE human A431 cells with CHM antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human SiHa cells with CHM antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CHM antibody.
IHC staining of FFPE human thyroid cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human placenta with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE mouse small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE rat small intestine with CHM antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunocytochemistry/Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CHM antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Rab escort protein 1 (REP1) also known as Rab proteins geranylgeranyltransferase component A 1, and Choroideremia protein, is an enzyme that in humans is encoded by the CHM gene. It is mapped to Xq21.2. This gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia; also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternatively spliced transcript variants have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein were used as the immunogen for the CHM antibody.
Limitation:
This CHM antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P24386