RHOB Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4915
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4915-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Antibody Clone: n/a
Regulatory Status: RUO
Target Species:
  • Human
  • Monkey
Applications:
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
After reconstitution, the RHOB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) placenta, 2) HepG2, 3) T-47D, 4) HeLa and 5) monkey COS-7 lysate with RHOB antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.
2 / 3
IHC staining of FFPE human breast cancer with RHOB antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 3
IHC staining of FFPE human renal cancer with RHOB antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
❮❯

Western blot testing of human 1) placenta, 2) HepG2, 3) T-47D, 4) HeLa and 5) monkey COS-7 lysate with RHOB antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.
IHC staining of FFPE human breast cancer with RHOB antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human renal cancer with RHOB antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the RHOB antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE from the human protein were used as the immunogen for the RHOB antibody.
Limitation:
This RHOB antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Monkey
Uniprot #:
P62745