HECTD3 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4929
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4929-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Antibody Clone: n/a
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
After reconstitution, the HECTD3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of 1) human Caco-2, 2) rat brain and 3) mouse brain lysate with HECTD3 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa.
2 / 5
IHC staining of FFPE human stomach tissue with HECTD3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
3 / 5
IHC staining of FFPE human lung tissue with HECTD3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
4 / 5
IHC staining of FFPE human lung tissue with HECTD3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
5 / 5
Flow cytometry testing of human A549 cells with HECTD3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HECTD3 antibody.
❮❯

Western blot testing of 1) human Caco-2, 2) rat brain and 3) mouse brain lysate with HECTD3 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa.
IHC staining of FFPE human stomach tissue with HECTD3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human lung tissue with HECTD3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human lung tissue with HECTD3 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
Flow cytometry testing of human A549 cells with HECTD3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HECTD3 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow Cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the HECTD3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. This gene is mapped to 1p34.1. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE from the human protein were used as the immunogen for the HECTD3 antibody.
Limitation:
This HECTD3 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q5T447