TMEM166 Antibody / EVA1A

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4951
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4951-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Antibody Clone: n/a
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
After reconstitution, the TMEM166 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of human 1) HepG2 and 2) PC-3 lysate with TMEM166 antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
2 / 4
IHC staining of FFPE human liver cancer with TMEM166 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
3 / 4
IHC staining of FFPE human renal cancer with TMEM166 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
4 / 4
Flow cytometry testing of human A549 cells with TMEM166 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TMEM166 antibody.
❮❯

Western blot testing of human 1) HepG2 and 2) PC-3 lysate with TMEM166 antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
IHC staining of FFPE human liver cancer with TMEM166 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
IHC staining of FFPE human renal cancer with TMEM166 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min and allow to cool before testing.
Flow cytometry testing of human A549 cells with TMEM166 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TMEM166 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow Cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the TMEM166 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA from the human protein were used as the immunogen for the TMEM166 antibody.
Limitation:
This TMEM166 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
Q9H8M9