NFIA Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4923
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4923-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 16H11
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the NFIA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 6
IHC staining of FFPE human tonsil with NFIA antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 6
IHC staining of FFPE human intestinal cancer with NFIA antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE human intestinal cancer with NFIA antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 6
Immunofluorescent staining of FFPE human A431 cells with NFIA antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
5 / 6
Western blot testing of human 1) HeLa and 2) HEK293 lysate with NFIA antibody. Expected molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
6 / 6
Flow cytometry testing of human U-2 OS cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NFIA antibody.
❮❯

IHC staining of FFPE human tonsil with NFIA antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with NFIA antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with NFIA antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A431 cells with NFIA antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa and 2) HEK293 lysate with NFIA antibody. Expected molecular weight ~56 kDa (unmodified), 60-70 kDa (phosphorylated).
Flow cytometry testing of human U-2 OS cells with NFIA antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= NFIA antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml, Flow Cytometry: 1-3ug/10^6 cells,Immunofluorescence: 2-4ug/ml
Application Note:
Optimal dilution of the NFIA antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimeric DNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiplegenes, differential splicing, and heterodimerization.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS from the human protein were used as the immunogen for the NFIA antibody.
Limitation:
This NFIA antibody is available for research use only.
Purity:
Purified
Species Reactivity :
Human
Uniprot #:
Q12857