Ku70/XRCC6 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6389
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6389-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 3D7
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Ku70/XRCC6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 9
Immunofluorescent staining of FFPE human U-2 OS cells with Ku70/XRCC6 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 9
IHC staining of FFPE human adrenocortical adenoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 9
IHC staining of FFPE human ovarian serous adenocarcinoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 9
IHC staining of FFPE human renal clear cell carcinoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 9
IHC staining of FFPE human gallbladder adenocarcinoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 9
IHC staining of FFPE human breast cancer tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 9
IHC staining of FFPE human rectal cancer tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 9
Western blot testing of human 1) HeLa, 2) A549, 3) HepG2 and 4) MCF7 cell lysate with Ku70/XRCC6 antibody. Predicted molecular weight ~70 kDa.
9 / 9
Flow cytometry testing of human ThP-1 cells with Ku70/XRCC6 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Ku70/XRCC6 antibody.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with Ku70/XRCC6 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human adrenocortical adenoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian serous adenocarcinoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human renal clear cell carcinoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human gallbladder adenocarcinoma tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human rectal cancer tissue with Ku70/XRCC6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HeLa, 2) A549, 3) HepG2 and 4) MCF7 cell lysate with Ku70/XRCC6 antibody. Predicted molecular weight ~70 kDa.
Flow cytometry testing of human ThP-1 cells with Ku70/XRCC6 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Ku70/XRCC6 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence (FFPE): 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Ku70/XRCC6 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a protein that in humans, is encoded by the XRCC6 gene. In addition, the XRCC6 gene encodes subunit p70 of the p70/p80 autoantigen which consists of 2 proteins of molecular mass of approximately 70,000 and 80,000 daltons that dimerize to form a 10 S DNA-binding complex. The XRCC6 gene is mapped to 22q13.2. XRCC6 and Mre11 are differentially expressed during meiosis. XRCC6 interacts with Baxa, a mediator of mitochondrial-dependent apoptosis. Disruption of both FANCC and XRCC6 suppressed sensitivity to crosslinking agents, diminished chromosome breaks, and reversed defective homologous recombination. Ku70 binds directly to free DNA ends, committing them to NHEJ repair. In early meiotic prophase, however, when meiotic recombination is most probably initiated, Mre11 was abundant, whereas XRCC6 was not detectable.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD were used as the immunogen for the Ku70/XRCC6 antibody.
Limitation:
This Ku70/XRCC6 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human
Uniprot #:
P12956