Beta Tubulin Antibody / TUBB

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6081
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6081-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 5E4.
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
After reconstitution, the Tubulin Beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 3
Immunofluorescent staining of FFPE human A431 cells with Tubulin Beta antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Western blot testing of human 1) HEK293, 2) HeLa, 3) HepG2, 4) HL-60, 5) Raji, 6) rat brain and 7) mouse brain lysate with Tubulin Beta antibody. Predicted molecular weight: ~50 kDa.
3 / 3
Flow cytometry testing of human SiHa cells with Tubulin Beta antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Tubulin Beta antibody.
❮❯

Immunofluorescent staining of FFPE human A431 cells with Tubulin Beta antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HEK293, 2) HeLa, 3) HepG2, 4) HL-60, 5) Raji, 6) rat brain and 7) mouse brain lysate with Tubulin Beta antibody. Predicted molecular weight: ~50 kDa.
Flow cytometry testing of human SiHa cells with Tubulin Beta antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Tubulin Beta antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Tubulin Beta antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE from the human protein were used as the immunogen for the Tubulin Beta antibody.
Limitation:
This Tubulin Beta antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P07437