14-3-3 zeta/delta Antibody / YWHAZ

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5642
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5642-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 6G5
Regulatory Status: RUO
Target Species:
  • Human
  • Monkey
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the YWHAZ antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 3
Flow cytometry testing of human PC-3 cells with YWHAZ antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YWHAZ antibody.
2 / 3
Flow cytometry testing of human SiHa cells with YWHAZ antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YWHAZ antibody.
3 / 3
Western blot testing of 1) human HeLa, 2) human A549, 3) monkey COS-7, 4) human Raji, 5) human Caco-2, 6) human Jurkat, 7) mouse brain and 8) rat brain lysate with YWHAZ antibody. Predicted molecular weight ~28 kDa.
❮❯

Flow cytometry testing of human PC-3 cells with YWHAZ antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YWHAZ antibody.
Flow cytometry testing of human SiHa cells with YWHAZ antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YWHAZ antibody.
Western blot testing of 1) human HeLa, 2) human A549, 3) monkey COS-7, 4) human Raji, 5) human Caco-2, 6) human Jurkat, 7) mouse brain and 8) rat brain lysate with YWHAZ antibody. Predicted molecular weight ~28 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the YWHAZ antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein were used as the immunogen for the YWHAZ antibody.
Limitation:
This YWHAZ antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat, Monkey
Uniprot #:
P63104