14-3-3 zeta/delta Antibody / YWHAZ
| Code | Size | Price |
|---|
| NSJ-RQ5643-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 6H7
Regulatory Status: RUO
Target Species:
- Human
- Monkey
- Mouse
- Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the 14-3-3 zeta/delta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the 14-3-3 zeta/delta antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein were used as the immunogen for the 14-3-3 zeta/delta antibody.
Limitation:
This 14-3-3 zeta/delta antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat, Monkey
Uniprot #:
P63104