AFF4 Antibody / AF4/FMR2 family member 4

NSJ Bioreagents
Product Code: NSJ-RQ6288
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6288-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 8G12
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of human 1) HeLa, 2) HepG2, 3) Caco-2, 4) HEK293, 5) MDA-MB-453, 6) PANC-1 and 7) SW620 cell lysate with AFF4 antibody. Predicted molecular weight ~127/98/39 kDa (isoforms 1/2/3).
2 / 2
Flow cytometry testing of human 293T cells with AFF4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AFF4 antibody.

Western blot testing of human 1) HeLa, 2) HepG2, 3) Caco-2, 4) HEK293, 5) MDA-MB-453, 6) PANC-1 and 7) SW620 cell lysate with AFF4 antibody. Predicted molecular weight ~127/98/39 kDa (isoforms 1/2/3).
Flow cytometry testing of human 293T cells with AFF4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AFF4 antibody.

Further Information

Application Details :
Western blot: 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the AFF4 antibody should be determined by the researcher.
Description:
The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.
Limitation:
This AFF4 antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
Q9UHB7