HMGB3 Antibody / HMG4

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6028
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6028-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 8H9
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
After reconstitution, the HMG4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 4
Immunofluorescent staining of FFPE human HeLa cells with HMG4 antibody. HIER: steam section in pH6 citrate buffer for 20 min.
2 / 4
Western blot testing of human 1) placenta, 2) HeLa, 3) T-47D, 4) HepG2, 5) Caco-2, 6) SW620 and 7) Raji lysate with HMG4 antibody. Predicted molecular weight ~23 kDa.
3 / 4
Western blot testing of 1) rat brain, 2) rat liver and 3) mouse ANA-1 lysate with HMG4 antibody. Predicted molecular weight ~23 kDa.
4 / 4
Flow cytometry testing of human HeLa cells with HMG4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMG4 antibody.
❮❯

Immunofluorescent staining of FFPE human HeLa cells with HMG4 antibody. HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) placenta, 2) HeLa, 3) T-47D, 4) HepG2, 5) Caco-2, 6) SW620 and 7) Raji lysate with HMG4 antibody. Predicted molecular weight ~23 kDa.
Western blot testing of 1) rat brain, 2) rat liver and 3) mouse ANA-1 lysate with HMG4 antibody. Predicted molecular weight ~23 kDa.
Flow cytometry testing of human HeLa cells with HMG4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMG4 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the HMG4 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Format :
Purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMG4 antibody.
Limitation:
This HMG4 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O15347