DHX15 Antibody / Prp43

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5627
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5627-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the DHX15 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 11
Immunofluorescent staining of FFPE human U-2 OS cells with DHX15 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 11
Flow cytometry testing of mouse ANA-1 cells with DHX15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DHX15 antibody.
3 / 11
Flow cytometry testing of A431 cells with DHX15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DHX15 antibody.
4 / 11
IHC staining of FFPE human placenta with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 11
IHC staining of FFPE human placenta with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 11
IHC staining of FFPE mouse brain with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 11
IHC staining of FFPE mouse small intestine with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 11
IHC staining of FFPE mouse small intestine with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
9 / 11
IHC staining of FFPE rat brain with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
10 / 11
IHC staining of FFPE rat small intestine with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
11 / 11
Western blot testing of human 1) HeLa, 2) HEK293 and 3) Caco-2 lysate with DHX15 antibody. Predicted molecular weight ~91 kDa.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with DHX15 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of mouse ANA-1 cells with DHX15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DHX15 antibody.
Flow cytometry testing of A431 cells with DHX15 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DHX15 antibody.
IHC staining of FFPE human placenta with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placenta with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse small intestine with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse small intestine with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat small intestine with DHX15 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HeLa, 2) HEK293 and 3) Caco-2 lysate with DHX15 antibody. Predicted molecular weight ~91 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the DHX15 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 is an enzyme that in humans is encoded by the DHX15 gene. It is mapped to 4p15.2. The protein encoded by this gene is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY from the human protein were used as the immunogen for the DHX15 antibody.
Limitation:
This DHX15 antibody is available for research use only.
Localization:
Nuclear
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O43143