MYH10 Antibody / non-muscle Myosin IIB

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5694
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5694-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the MYH10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 8
Immunofluorescent staining of FFPE human A431 cells with MYH10 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 8
IHC staining of FFPE human breast cancer with MYH10 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE human breast cancer with MYH10 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 8
IHC staining of FFPE rat brain with MYH10 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 8
Flow cytometry testing of human A431 cells with MYH10 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MYH10 antibody.
6 / 8
Flow cytometry testing of mouse ANA-1 cells with MYH10 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MYH10 antibody.
7 / 8
Flow cytometry testing of rat C6 cells with MYH10 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MYH10 antibody.
8 / 8
Western blot testing of 1) rat brain, 2) mouse brain, 3) mouse NIH 3T3 and 4) human SK-OV-3 lysate with MYH10 antibody. Predicted molecular weight ~229 kDa.
❮❯

Immunofluorescent staining of FFPE human A431 cells with MYH10 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human breast cancer with MYH10 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with MYH10 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with MYH10 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Flow cytometry testing of human A431 cells with MYH10 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MYH10 antibody.
Flow cytometry testing of mouse ANA-1 cells with MYH10 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MYH10 antibody.
Flow cytometry testing of rat C6 cells with MYH10 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MYH10 antibody.
Western blot testing of 1) rat brain, 2) mouse brain, 3) mouse NIH 3T3 and 4) human SK-OV-3 lysate with MYH10 antibody. Predicted molecular weight ~229 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the MYH10 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QRTGLEDPERYLFVDRAVIYNPATQADWTAKK from the human protein were used as the immunogen for the MYH10 antibody.
Limitation:
This MYH10 antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P35580