IL-18R Beta Antibody
| Code | Size | Price |
|---|
| NSJ-RQ6190-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the IL-18R Beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 1-2ug/ml
Application Note:
Optimal dilution of the IL-18R Beta antibody should be determined by the researcher.
Description:
Interleukin 18 receptor accessory protein, also known as IL18RAP and CDw218b (cluster of differentiation w218b), is a human gene. The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor and plays a role in signaling by IL18. Mutations in this gene are associated with Crohn's disease and inflammatory bowel disease, and susceptibility to celiac disease and leprosy. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids SIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALR from the human protein were used as the immunogen for the IL-18R Beta antibody.
Limitation:
This IL-18R Beta antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
O95256