MSI1 Antibody / Musashi 1

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5992
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5992-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the Musashi 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 2
Flow cytometry testing of human A549 cells with Musashi 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Musashi 1 antibody.
2 / 2
Western blot testing of human 1) U-2 OS, 2) T-47D and 3) COLO-320 lysate with Musashi 1 antibody. Predicted molecular weight ~39 kDa.
❮❯

Flow cytometry testing of human A549 cells with Musashi 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Musashi 1 antibody.
Western blot testing of human 1) U-2 OS, 2) T-47D and 3) COLO-320 lysate with Musashi 1 antibody. Predicted molecular weight ~39 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells,Direct ELISA: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the Musashi 1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Musashi 1 antibody.
Limitation:
This Musashi 1 antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
O43347