MORC3 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6060
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6060-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the MORC3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 5
IHC staining of FFPE human rectal cancer with MORC3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 5
IHC staining of FFPE human breast cancer with MORC3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 5
Immunofluorescent staining of FFPE human A431 cells with MORC3 antibody (green). HIER: steam section in pH6 citrate buffer for 20 min.
4 / 5
Western blot testing of 1) rat heart, 2) rat liver and 3) mouse heart lysate with MORC3 antibody. Expected molecular weight: 107-130 kDa depending on level of SUMOylation.
5 / 5
Flow cytometry testing of human A431 cells with MORC3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MORC3 antibody.
❮❯

IHC staining of FFPE human rectal cancer with MORC3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with MORC3 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A431 cells with MORC3 antibody (green). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) rat heart, 2) rat liver and 3) mouse heart lysate with MORC3 antibody. Expected molecular weight: 107-130 kDa depending on level of SUMOylation.
Flow cytometry testing of human A431 cells with MORC3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MORC3 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the MORC3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
MORC family CW-type zinc finger protein 3 is a protein that in humans is encoded by the MORC3 gene. This gene is mapped to 21q22.12. This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD from the human protein were used as the immunogen for the MORC3 antibody.
Limitation:
This MORC3 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q14149