Synaptopodin Antibody / SYNPO

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5766
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5766-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the SYNPO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 6
Immunofluorescent staining of FFPE human U-2 OS cells with SYNPO antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
IHC staining of FFPE human renal cancer with SYNPO antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE mouse brain with SYNPO antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE rat brain with SYNPO antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 6
Western blot testing of 1) rat brain, 2) mouse brain and 3) human SH-SY5Y lysate with SYNPO antibody. Expected molecular weight ~99 kDa.
6 / 6
Flow cytometry testing of human U-87 MG cells with SYNPO antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SYNPO antibody.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with SYNPO antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human renal cancer with SYNPO antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with SYNPO antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with SYNPO antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) rat brain, 2) mouse brain and 3) human SH-SY5Y lysate with SYNPO antibody. Expected molecular weight ~99 kDa.
Flow cytometry testing of human U-87 MG cells with SYNPO antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SYNPO antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the SYNPO antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The spine apparatus (SA) is a specialized form of endoplasmic reticulum (ER) that is found in a subpopulation of dendritic spines in central neurons. The SA consists of a series of stacked discs that are though to be connected to each other and to the dendritic system of ER-tubules. The actin binding protein synaptopodin (which has originally been described in podocytes of the kidney) is an essential component of the SA. Mice that lack the gene for synaptopodin do not form a spine apparatus. The SA is believed to play a critical role in learning and memory. In summary, an important function of the spine apparatus is the regulation of plasticity at individual synapses, a process known as metaplasticity. The International Radiation Hybrid Mapping Consortium mapped the SYNPO gene to chromosome 5.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EKPKVTPNPDLLDLVQTADEKRRQRDHGEVGMEEE from the human protein were used as the immunogen for the SYNPO antibody.
Limitation:
This SYNPO antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q8N3V7