Vinexin Antibody / SORBS3

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6010
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6010-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Vinexin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 8
IHC staining of FFPE mouse intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 8
IHC staining of FFPE mouse intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE liver cancer with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 8
IHC staining of FFPE rat intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 8
IHC staining of FFPE rat intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 8
Immunofluorescent staining of FFPE human A549 cells with Vinexin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
7 / 8
Western blot testing of 1) human ThP-1, 2) rat liver, 3) mouse brain and 4) mouse HEPA1-6 lysate with Vinexin antibody. Predicted molecular weight ~75 kDa.
8 / 8
Flow cytometry testing of human A431 cells with Vinexin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD59 antibody.
❮❯

IHC staining of FFPE mouse intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE liver cancer with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A549 cells with Vinexin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human ThP-1, 2) rat liver, 3) mouse brain and 4) mouse HEPA1-6 lysate with Vinexin antibody. Predicted molecular weight ~75 kDa.
Flow cytometry testing of human A431 cells with Vinexin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD59 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry: 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Vinexin antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Vinexin is a protein that in humans is encoded by the SORBS3 gene. It is mapped to 8p21.3. This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE from the human protein were used as the immunogen for the Vinexin antibody.
Limitation:
This Vinexin antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O60504