SUMO1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6212
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6212-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
After reconstitution, the SUMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 8
IHC staining of FFPE human breast cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 8
IHC staining of FFPE human intestinal cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 8
IHC staining of FFPE mouse brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 8
IHC staining of FFPE mouse brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 8
IHC staining of FFPE rat brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 8
Immunofluorescent staining of FFPE human A431 cells with SUMO1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
7 / 8
Flow cytometry testing of human HL60 cells with SUMO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SUMO1 antibody.
8 / 8
Flow cytometry testing of human HEPA1-6 cells with SUMO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SUMO1 antibody.
❮❯

IHC staining of FFPE human breast cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with SUMO1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A431 cells with SUMO1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human HL60 cells with SUMO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SUMO1 antibody.
Flow cytometry testing of human HEPA1-6 cells with SUMO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= SUMO1 antibody.

Documents

Further Information

Application Details :
Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the SUMO1 antibody should be determined by the researcher.
Description:
Small ubiquitin-related modifier 1(SUMO1), also called SMT3C or PIC1 is a protein that in humans is encoded by the SUMO1 gene. This gene is mapped to 2q33.1. This gene encodes a protein that is a member of the SUMO(small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids HLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKEL from the human protein were used as the immunogen for the SUMO1 antibody.
Limitation:
This SUMO1 antibody is available for research use only.
Localization:
Predominantly nuclear with some cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P63165