EEF2 Antibody / Elongation factor 2

Product Code: NSJ-RQ6253

Code	Size	Price

NSJ-RQ6253-100ug

100 ug

£535.00

Quantity:

Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit

Antibody Isotype: Rabbit IgG

Antibody Clonality: Polyclonal

Regulatory Status: RUO

Target Species:

Human
Monkey
Mouse
Rat

Applications:

Fluorescence-activated cell sorting (FACS)
Immunofluorescence (IF)
Immunohistochemistry- Paraffin Embedded (IHC-P)
Western Blot (WB)

Storage:

After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 13

Western blot testing of rat 1) kidney, 2) lung, 3) stomach, 4) C6 and mouse 5) kidney, 6) lung, 7) stomach and 8) NIH 3T3 cell lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.

2 / 13

Western blot testing of 1) human Jurkat, 2) monkey COS-7 and human 3) HeLa, 4) U-2 OS, 5) HEK293, 6) HepG2 and 7) placenta lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.

3 / 13

IHC staining of FFPE human gastric cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

4 / 13

IHC staining of FFPE human ovarian cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

5 / 13

6 / 13

IHC staining of FFPE human rectal cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

7 / 13

IHC staining of FFPE human prostate cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

8 / 13

IHC staining of FFPE human breast cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

9 / 13

IHC staining of FFPE human esophageal squamous carcinoma tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

10 / 13

IHC staining of FFPE mouse brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

11 / 13

IHC staining of FFPE rat brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

12 / 13

Immunofluorescent staining of FFPE human A431 cells with Elongation factor 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

13 / 13

Flow cytometry testing of human U937 cells with Elongation factor 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Elongation factor 2 antibody.

❮❯

Documents

Further Information

Application Details :

Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells

Application Note:

Optimal dilution of the Elongation factor 2 antibody should be determined by the researcher.

Description:

Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Format :

Antigen affinity purified

Formulation :

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Immunogen:

Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.

Limitation:

This Elongation factor 2 antibody is available for research use only.

Localization:

Cytoplasmic, nuclear

Purity:

Affinity purified

Species Reactivity :

Human, Mouse, Rat, Monkey

Uniprot #:

P13639