ZEB1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5497
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5497-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the ZEB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of human 1) SGC-7901, 2) U-87 MG, 3) HEK293 and 4) PC-3 cell lysate with ZEB1 antibody. Predicted molecular weight ~124 kDa but observed at up to ~200 kDa.
2 / 5
Immunofluorescent staining of FFPE human U-2 OS cells with ZEB1 antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 5
IHC staining of FFPE human glioma tissue with ZEB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
4 / 5
IHC staining of FFPE human melanoma tissue with ZEB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
5 / 5
Flow cytometry testing of human U-2 OS cells with ZEB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ZEB1 antibody.
❮❯

Western blot testing of human 1) SGC-7901, 2) U-87 MG, 3) HEK293 and 4) PC-3 cell lysate with ZEB1 antibody. Predicted molecular weight ~124 kDa but observed at up to ~200 kDa.
Immunofluorescent staining of FFPE human U-2 OS cells with ZEB1 antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human glioma tissue with ZEB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human melanoma tissue with ZEB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Flow cytometry testing of human U-2 OS cells with ZEB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ZEB1 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the ZEB1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Zinc finger E-box-binding homeobox 1 is a protein that in humans is encoded by the ZEB1 gene. It is mapped to 10p11.22. This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the ZEB1 antibody.
Limitation:
This ZEB1 antibody is available for research use only.
Localization:
Nuclear
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
P37275