HMGB1 Antibody

NSJ Bioreagents
Product Code: NSJ-RQ5513
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5513-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 5H3
Regulatory Status: RUO
Target Species:
  • Human
  • Monkey
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the HMGB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 7
IHC staining of FFPE human breast cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
2 / 7
IHC staining of FFPE human intestinal cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE human lung cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
4 / 7
Western blot testing of 1) human HepG2, 2) human CCRF-CEM, 3) monkey COS-7, 4) human SW620, 5) human ThP-1, 6) rat PC-12, 7) rat RH35 and 8) mouse NIH3T3 with HMGB1 antibody. Predicted molecular weight ~25 kDa.
5 / 7
Flow cytometry testing of human SiHa cells with HMGB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB1 antibody.
6 / 7
IHC staining of FFPE mouse brain with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
7 / 7
IHC staining of FFPE rat brain with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.

IHC staining of FFPE human breast cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Western blot testing of 1) human HepG2, 2) human CCRF-CEM, 3) monkey COS-7, 4) human SW620, 5) human ThP-1, 6) rat PC-12, 7) rat RH35 and 8) mouse NIH3T3 with HMGB1 antibody. Predicted molecular weight ~25 kDa.
Flow cytometry testing of human SiHa cells with HMGB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB1 antibody.
IHC staining of FFPE mouse brain with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.

Further Information

Application Details :
Western blot: 0.5-1ug/ml, Flow cytometry: 1-3ug/million cells,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the HMGB1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK were used as the immunogen for the HMGB1 antibody.
Limitation:
This HMGB1 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic, cell membrane, extracellular
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat, Monkey
Uniprot #:
P09429