ALDH2 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5544
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5544-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2a
Antibody Clonality: Monoclonal
Antibody Clone: 5G7
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Western Blot (WB)
Storage:
After reconstitution, the ALDH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 4
Flow cytometry testing of human A549 cells with ALDH2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALDH2 antibody.
2 / 4
Western blot testing of human 1) HepG2, 2) placenta, 3) HEK293, 4) SHG-44 and 5) ThP-1 lysate with ALDH2 antibody. Predicted molecular weight ~56 kDa.
3 / 4
Western blot testing of 1) rat liver, 2) rat kidney, 3) rat heart, 4) mouse liver and 5) mouse kidney lysate with ALDH2 antibody. Predicted molecular weight ~56 kDa.
4 / 4
Immunofluorescent staining of FFPE human A431 cells with ALDH2 antibody (green) and DAPI nuclear stain (blue).
❮❯

Flow cytometry testing of human A549 cells with ALDH2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALDH2 antibody.
Western blot testing of human 1) HepG2, 2) placenta, 3) HEK293, 4) SHG-44 and 5) ThP-1 lysate with ALDH2 antibody. Predicted molecular weight ~56 kDa.
Western blot testing of 1) rat liver, 2) rat kidney, 3) rat heart, 4) mouse liver and 5) mouse kidney lysate with ALDH2 antibody. Predicted molecular weight ~56 kDa.
Immunofluorescent staining of FFPE human A431 cells with ALDH2 antibody (green) and DAPI nuclear stain (blue).

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells,Immunofluorescence: 2-4ug/ml
Application Note:
Optimal dilution of the ALDH2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody.
Limitation:
This ALDH2 antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P05091