LRTOMT Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5590
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5590-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the LRTOMT antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 7
IHC staining of FFPE human lung cancer with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
2 / 7
IHC staining of FFPE human placenta with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE mouse brain with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE mouse brain with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
5 / 7
IHC staining of FFPE rat brain with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
6 / 7
Western blot testing of human 1) placenta, 2) MCF7, 3) HeLa, 4) Caco-2, 5) U-2 OS and 6) ThP-1 lysate with LRTOMT antibody. Expected molecular weight: 28-32 kDa.
7 / 7
Western blot testing of 1) rat brain, 2) rat ovary, 3) rat heart, 4) rat lung, 5) mouse brain and 6) mouse lung lysate with LRTOMT antibody. Expected molecular weight: 28-32 kDa.
❮❯

IHC staining of FFPE human lung cancer with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human placenta with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with LRTOMT antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Western blot testing of human 1) placenta, 2) MCF7, 3) HeLa, 4) Caco-2, 5) U-2 OS and 6) ThP-1 lysate with LRTOMT antibody. Expected molecular weight: 28-32 kDa.
Western blot testing of 1) rat brain, 2) rat ovary, 3) rat heart, 4) rat lung, 5) mouse brain and 6) mouse lung lysate with LRTOMT antibody. Expected molecular weight: 28-32 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the LRTOMT antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Leucine rich transmembrane and O-methyltransferase domain containing is a protein that in humans is encoded by the LRTOMT gene. It is mapped to 11q13.4. This gene has evolved in primates as a fusion of two ancestral neighboring genes, Lrrc51 and Tomt, which exist as two independent genes in rodents. The fusion gene contains some shared exons, but encodes structurally unrelated proteins, LRTOMT1 and LRTOMT2. Those variants that utilize the more centromere-proximal 3' terminal exon (short transcript form) encode LRTOMT1, while those variants that use a more centromere-distal 3' terminal exon (long transcript form) encode the LRTOMT2 protein. There is a small region within one of the exons of this gene that contains overlapping alternate reading frames for both LRTOMT1 and LRTOMT2. LRTOMT1 shares similarity with the protein encoded by mouse Lrrc51, while LRTOMT2 shares similarity with the protein encoded by mouse Tomt. Alternative splicing results in multiple transcript variants, encoding different isoforms of both LRTOMT1 and LRTOMT2. The LRTOMT1 protein is a leucine-rich repeat-containing protein, while the LRTOMT2 protein is a catechol-O-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to a hydroxyl group of catechols and is essential for auditory and vestibular function. Mutations in this gene have been associated with nonsyndromic deafness.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL were used as the immunogen for the LRTOMT antibody.
Limitation:
This LRTOMT antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q8WZ04