Beta Tubulin Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ5619
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ5619-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2a
Antibody Clonality: Monoclonal
Antibody Clone: 2E11.
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunocytochemistry (ICC)
  • Western Blot (WB)
Storage:
After reconstitution, the Beta Tubulin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 6
IF/ICC staining of FFPE human U-2 OS cells with Beta Tubulin antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
IF/ICC staining of FFPE human U-2 OS cells with Beta Tubulin antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
3 / 6
Western blot testing of 1) human HEK293, 2) monkey COS-7, 3) human PC-3 and 4) human HeLa cell lysate with Beta Tubulin antibody. Predicted molecular weight: 50-55 kDa.
4 / 6
Western blot testing of rat 1) brain, 2) liver, 3) PC-12 and mouse 4) brain, 5) NIH3T3 and 6) RAW264.7 cell lysate with Beta Tubulin antibody. Predicted molecular weight: 50-55 kDa.
5 / 6
Flow cytometry testing of human U937 cells with Beta Tubulin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Beta Tubulin antibody.
6 / 6
Flow cytometry testing of human HEPA1-6 cells with Beta Tubulin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Beta Tubulin antibody.
❮❯

IF/ICC staining of FFPE human U-2 OS cells with Beta Tubulin antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human U-2 OS cells with Beta Tubulin antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HEK293, 2) monkey COS-7, 3) human PC-3 and 4) human HeLa cell lysate with Beta Tubulin antibody. Predicted molecular weight: 50-55 kDa.
Western blot testing of rat 1) brain, 2) liver, 3) PC-12 and mouse 4) brain, 5) NIH3T3 and 6) RAW264.7 cell lysate with Beta Tubulin antibody. Predicted molecular weight: 50-55 kDa.
Flow cytometry testing of human U937 cells with Beta Tubulin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Beta Tubulin antibody.
Flow cytometry testing of human HEPA1-6 cells with Beta Tubulin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Beta Tubulin antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/10^6 cells,Immunocytochemistry: 2-4ug/ml
Application Note:
Optimal dilution of the Beta Tubulin antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE were used as the immunogen for the Beta Tubulin antibody.
Limitation:
This Beta Tubulin antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P07437